SCOPe 2.04: Domain d3oehw3: 3oeh W:358-474

Lineage for d3oehw3 (3oeh W:358-474)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (6 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255214] (6 PDB entries)

8. Domain d3oehw3: 3oeh W:358-474 [248242]
   Other proteins in same PDB: d3oehd1, d3oehd2, d3oehe1, d3oehe2, d3oehf1, d3oehf2, d3oehg_, d3oehm1, d3oehm2, d3oehn1, d3oehn2, d3oeho1, d3oeho2, d3oehp_, d3oehv1, d3oehv2, d3oehw1, d3oehw2, d3oehx1, d3oehx2
   automated match to d2jdid1
   complexed with anp, mg; mutant

Details for d3oehw3

PDB Entry: 3oeh, 3 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: beta-V279F

PDB Compounds: (W:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oehw3:

Sequence; same for both SEQRES and ATOM records:

>d3oehw3 a.69.1.0 (W:358-474) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla

Timeline for d3oehw3:

• d3oehw3 is new in SCOPe 2.04-stable
  
• d3oehw3 appears in SCOPe 2.05
  
• d3oehw3 appears in the current release, SCOPe 2.08