Lineage for d3oehw1 (3oeh W:8-82)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1795771Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1795772Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) (S)
    automatically mapped to Pfam PF02874
  5. 1795900Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 1795901Protein automated matches [254527] (7 species)
    not a true protein
  7. 1795909Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255212] (6 PDB entries)
  8. 1795950Domain d3oehw1: 3oeh W:8-82 [248240]
    Other proteins in same PDB: d3oehd2, d3oehd3, d3oehe2, d3oehe3, d3oehf2, d3oehf3, d3oehg_, d3oehm2, d3oehm3, d3oehn2, d3oehn3, d3oeho2, d3oeho3, d3oehp_, d3oehv2, d3oehv3, d3oehw2, d3oehw3, d3oehx2, d3oehx3
    automated match to d2jdid2
    complexed with anp, mg; mutant

Details for d3oehw1

PDB Entry: 3oeh (more details), 3 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: beta-V279F
PDB Compounds: (W:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oehw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oehw1 b.49.1.0 (W:8-82) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdgt
eglvrgekvldtggp

SCOPe Domain Coordinates for d3oehw1:

Click to download the PDB-style file with coordinates for d3oehw1.
(The format of our PDB-style files is described here.)

Timeline for d3oehw1: