Lineage for d3oehv3 (3oeh V:358-475)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002731Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2002732Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) (S)
  5. 2002733Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 2002804Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species)
  7. 2002807Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310898] (6 PDB entries)
  8. 2002847Domain d3oehv3: 3oeh V:358-475 [248239]
    Other proteins in same PDB: d3oehd1, d3oehd2, d3oehe1, d3oehe2, d3oehf1, d3oehf2, d3oehg_, d3oehh1, d3oehh2, d3oehi_, d3oehm1, d3oehm2, d3oehn1, d3oehn2, d3oeho1, d3oeho2, d3oehp_, d3oehr_, d3oehv1, d3oehv2, d3oehw1, d3oehw2, d3oehx1, d3oehx2
    automated match to d2jdid1
    complexed with anp, mg; mutant

Details for d3oehv3

PDB Entry: 3oeh (more details), 3 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: beta-V279F
PDB Compounds: (V:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oehv3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oehv3 a.69.1.1 (V:358-475) F1 ATP synthase beta subunit, domain 3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa

SCOPe Domain Coordinates for d3oehv3:

Click to download the PDB-style file with coordinates for d3oehv3.
(The format of our PDB-style files is described here.)

Timeline for d3oehv3: