Lineage for d3oeho2 (3oeh O:83-357)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2126370Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2126501Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species)
  7. 2126504Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310897] (6 PDB entries)
  8. 2126543Domain d3oeho2: 3oeh O:83-357 [248234]
    Other proteins in same PDB: d3oehd1, d3oehd3, d3oehe1, d3oehe3, d3oehf1, d3oehf3, d3oehg_, d3oehh1, d3oehh2, d3oehi_, d3oehm1, d3oehm3, d3oehn1, d3oehn3, d3oeho1, d3oeho3, d3oehp_, d3oehr_, d3oehv1, d3oehv3, d3oehw1, d3oehw3, d3oehx1, d3oehx3
    automated match to d2jdid3
    complexed with anp, mg; mutant

Details for d3oeho2

PDB Entry: 3oeh (more details), 3 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: beta-V279F
PDB Compounds: (O:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oeho2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oeho2 c.37.1.11 (O:83-357) Central domain of beta subunit of F1 ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isvpvgretlgriinvigepidergpiksklrkpihadppsfaeqstsaeiletgikvvd
llapyarggkiglfggagvgktvfiqelinniakahggfsvftgvgertregndlyremk
etgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdeegqdvllfidnifrft
qagsevsallgripsafgyqptlatdmgllqeritttkkgsvtsvqavyvpaddltdpap
attfahldattvlsrgiselgiypavdpldsksrl

SCOPe Domain Coordinates for d3oeho2:

Click to download the PDB-style file with coordinates for d3oeho2.
(The format of our PDB-style files is described here.)

Timeline for d3oeho2: