Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein automated matches [190393] (9 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255213] (6 PDB entries) |
Domain d3oeho2: 3oeh O:83-357 [248234] Other proteins in same PDB: d3oehd1, d3oehd3, d3oehe1, d3oehe3, d3oehf1, d3oehf3, d3oehg_, d3oehm1, d3oehm3, d3oehn1, d3oehn3, d3oeho1, d3oeho3, d3oehp_, d3oehv1, d3oehv3, d3oehw1, d3oehw3, d3oehx1, d3oehx3 automated match to d2jdid3 complexed with anp, mg; mutant |
PDB Entry: 3oeh (more details), 3 Å
SCOPe Domain Sequences for d3oeho2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oeho2 c.37.1.11 (O:83-357) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} isvpvgretlgriinvigepidergpiksklrkpihadppsfaeqstsaeiletgikvvd llapyarggkiglfggagvgktvfiqelinniakahggfsvftgvgertregndlyremk etgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdeegqdvllfidnifrft qagsevsallgripsafgyqptlatdmgllqeritttkkgsvtsvqavyvpaddltdpap attfahldattvlsrgiselgiypavdpldsksrl
Timeline for d3oeho2:
View in 3D Domains from other chains: (mouse over for more information) d3oehd1, d3oehd2, d3oehd3, d3oehe1, d3oehe2, d3oehe3, d3oehf1, d3oehf2, d3oehf3, d3oehg_, d3oehm1, d3oehm2, d3oehm3, d3oehn1, d3oehn2, d3oehn3, d3oehp_, d3oehv1, d3oehv2, d3oehv3, d3oehw1, d3oehw2, d3oehw3, d3oehx1, d3oehx2, d3oehx3 |