SCOPe 2.04: Domain d3oeho2: 3oeh O:83-357

Lineage for d3oeho2 (3oeh O:83-357)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein automated matches [190393] (9 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255213] (6 PDB entries)

8. Domain d3oeho2: 3oeh O:83-357 [248234]
   Other proteins in same PDB: d3oehd1, d3oehd3, d3oehe1, d3oehe3, d3oehf1, d3oehf3, d3oehg_, d3oehm1, d3oehm3, d3oehn1, d3oehn3, d3oeho1, d3oeho3, d3oehp_, d3oehv1, d3oehv3, d3oehw1, d3oehw3, d3oehx1, d3oehx3
   automated match to d2jdid3
   complexed with anp, mg; mutant

Details for d3oeho2

PDB Entry: 3oeh, 3 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: beta-V279F

PDB Compounds: (O:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oeho2:

Sequence; same for both SEQRES and ATOM records:

>d3oeho2 c.37.1.11 (O:83-357) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isvpvgretlgriinvigepidergpiksklrkpihadppsfaeqstsaeiletgikvvd
llapyarggkiglfggagvgktvfiqelinniakahggfsvftgvgertregndlyremk
etgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdeegqdvllfidnifrft
qagsevsallgripsafgyqptlatdmgllqeritttkkgsvtsvqavyvpaddltdpap
attfahldattvlsrgiselgiypavdpldsksrl

Timeline for d3oeho2:

• d3oeho2 is new in SCOPe 2.04-stable
  
• d3oeho2 appears in SCOPe 2.05
  
• d3oeho2 appears in the current release, SCOPe 2.08