Lineage for d3oehg_ (3oeh G:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1855807Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1855955Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 1855986Family c.49.2.0: automated matches [191450] (1 protein)
    not a true family
  6. 1855987Protein automated matches [190687] (2 species)
    not a true protein
  7. 1855990Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187815] (6 PDB entries)
  8. 1856001Domain d3oehg_: 3oeh G: [248226]
    Other proteins in same PDB: d3oehd1, d3oehd2, d3oehd3, d3oehe1, d3oehe2, d3oehe3, d3oehf1, d3oehf2, d3oehf3, d3oehm1, d3oehm2, d3oehm3, d3oehn1, d3oehn2, d3oehn3, d3oeho1, d3oeho2, d3oeho3, d3oehv1, d3oehv2, d3oehv3, d3oehw1, d3oehw2, d3oehw3, d3oehx1, d3oehx2, d3oehx3
    automated match to d2v7qg_
    complexed with anp, mg; mutant

Details for d3oehg_

PDB Entry: 3oeh (more details), 3 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: beta-V279F
PDB Compounds: (G:) ATP synthase subunit gamma

SCOPe Domain Sequences for d3oehg_:

Sequence, based on SEQRES records: (download)

>d3oehg_ c.49.2.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
sknagdminrysilynrtrqavitnelvdiitgass

Sequence, based on observed residues (ATOM records): (download)

>d3oehg_ c.49.2.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
kelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllrthpnniklsi
ngigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsekpifnaktieq
spsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdnasknagdminr
ysilynrtrqavitnelvdiitgass

SCOPe Domain Coordinates for d3oehg_:

Click to download the PDB-style file with coordinates for d3oehg_.
(The format of our PDB-style files is described here.)

Timeline for d3oehg_: