Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold |
Family c.49.2.0: automated matches [191450] (1 protein) not a true family |
Protein automated matches [190687] (2 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187815] (6 PDB entries) |
Domain d3oehg_: 3oeh G: [248226] Other proteins in same PDB: d3oehd1, d3oehd2, d3oehd3, d3oehe1, d3oehe2, d3oehe3, d3oehf1, d3oehf2, d3oehf3, d3oehm1, d3oehm2, d3oehm3, d3oehn1, d3oehn2, d3oehn3, d3oeho1, d3oeho2, d3oeho3, d3oehv1, d3oehv2, d3oehv3, d3oehw1, d3oehw2, d3oehw3, d3oehx1, d3oehx2, d3oehx3 automated match to d2v7qg_ complexed with anp, mg; mutant |
PDB Entry: 3oeh (more details), 3 Å
SCOPe Domain Sequences for d3oehg_:
Sequence, based on SEQRES records: (download)
>d3oehg_ c.49.2.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna sknagdminrysilynrtrqavitnelvdiitgass
>d3oehg_ c.49.2.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl kelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllrthpnniklsi ngigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsekpifnaktieq spsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdnasknagdminr ysilynrtrqavitnelvdiitgass
Timeline for d3oehg_:
View in 3D Domains from other chains: (mouse over for more information) d3oehd1, d3oehd2, d3oehd3, d3oehe1, d3oehe2, d3oehe3, d3oehf1, d3oehf2, d3oehf3, d3oehm1, d3oehm2, d3oehm3, d3oehn1, d3oehn2, d3oehn3, d3oeho1, d3oeho2, d3oeho3, d3oehp_, d3oehv1, d3oehv2, d3oehv3, d3oehw1, d3oehw2, d3oehw3, d3oehx1, d3oehx2, d3oehx3 |