Lineage for d3oehe3 (3oeh E:358-475)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739159Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1739160Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families) (S)
  5. 1739288Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 1739289Protein automated matches [254528] (7 species)
    not a true protein
  7. 1739297Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255214] (6 PDB entries)
  8. 1739332Domain d3oehe3: 3oeh E:358-475 [248222]
    Other proteins in same PDB: d3oehd1, d3oehd2, d3oehe1, d3oehe2, d3oehf1, d3oehf2, d3oehg_, d3oehm1, d3oehm2, d3oehn1, d3oehn2, d3oeho1, d3oeho2, d3oehp_, d3oehv1, d3oehv2, d3oehw1, d3oehw2, d3oehx1, d3oehx2
    automated match to d2jdid1
    complexed with anp, mg; mutant

Details for d3oehe3

PDB Entry: 3oeh (more details), 3 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: beta-V279F
PDB Compounds: (E:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oehe3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oehe3 a.69.1.0 (E:358-475) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa

SCOPe Domain Coordinates for d3oehe3:

Click to download the PDB-style file with coordinates for d3oehe3.
(The format of our PDB-style files is described here.)

Timeline for d3oehe3: