![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
![]() | Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) ![]() automatically mapped to Pfam PF02874 |
![]() | Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
![]() | Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310896] (6 PDB entries) |
![]() | Domain d3oehe1: 3oeh E:8-82 [248220] Other proteins in same PDB: d3oehd2, d3oehd3, d3oehe2, d3oehe3, d3oehf2, d3oehf3, d3oehg_, d3oehh1, d3oehh2, d3oehi_, d3oehm2, d3oehm3, d3oehn2, d3oehn3, d3oeho2, d3oeho3, d3oehp_, d3oehr_, d3oehv2, d3oehv3, d3oehw2, d3oehw3, d3oehx2, d3oehx3 automated match to d2jdid2 complexed with anp, mg; mutant |
PDB Entry: 3oeh (more details), 3 Å
SCOPe Domain Sequences for d3oehe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oehe1 b.49.1.1 (E:8-82) F1 ATP synthase beta subunit, domain 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdgt eglvrgekvldtggp
Timeline for d3oehe1:
![]() Domains from other chains: (mouse over for more information) d3oehd1, d3oehd2, d3oehd3, d3oehf1, d3oehf2, d3oehf3, d3oehg_, d3oehh1, d3oehh2, d3oehi_, d3oehm1, d3oehm2, d3oehm3, d3oehn1, d3oehn2, d3oehn3, d3oeho1, d3oeho2, d3oeho3, d3oehp_, d3oehr_, d3oehv1, d3oehv2, d3oehv3, d3oehw1, d3oehw2, d3oehw3, d3oehx1, d3oehx2, d3oehx3 |