![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) ![]() |
![]() | Family a.102.4.4: Complement components [48251] (4 proteins) probably related to other families, but has no known enzymatic activity |
![]() | Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48253] (19 PDB entries) |
![]() | Domain d3oedb1: 3oed B:3-294 [248212] Other proteins in same PDB: d3oeda2, d3oedb2, d3oedc1, d3oedc2, d3oedd1, d3oedd2 automated match to d1ghqa_ |
PDB Entry: 3oed (more details), 3.16 Å
SCOPe Domain Sequences for d3oedb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oedb1 a.102.4.4 (B:3-294) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]} daerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytq qlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpd gvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdf leanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsy allallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap
Timeline for d3oedb1: