SCOPe 2.08: Domain d3oedb1: 3oed B:3-294

Lineage for d3oedb1 (3oed B:3-294)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.4: Complement components [48251] (4 proteins)
   probably related to other families, but has no known enzymatic activity

6. Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48253] (19 PDB entries)

8. Domain d3oedb1: 3oed B:3-294 [248212]
   Other proteins in same PDB: d3oeda2, d3oedb2, d3oedc1, d3oedc2, d3oedd1, d3oedd2
   automated match to d1ghqa_

Details for d3oedb1

PDB Entry: 3oed, 3.16 Å

PDB Description: The structure of the complex between complement receptor CR2 and its ligand complement fragment C3d

PDB Compounds: (B:) Complement C3

SCOPe Domain Sequences for d3oedb1:

Sequence; same for both SEQRES and ATOM records:

>d3oedb1 a.102.4.4 (B:3-294) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
daerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytq
qlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpd
gvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdf
leanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsy
allallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap

Timeline for d3oedb1:

• d3oedb1 first appeared in SCOPe 2.04, called d3oedb_
  
• d3oedb1 appears in SCOPe 2.07