SCOPe 2.05: Domain d3oeda_: 3oed A:

Lineage for d3oeda_ (3oed A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.4: Complement components [48251] (4 proteins)
   probably related to other families, but has no known enzymatic activity

6. Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48253] (16 PDB entries)

8. Domain d3oeda_: 3oed A: [248211]
   Other proteins in same PDB: d3oedc1, d3oedc2, d3oedd1, d3oedd2
   automated match to d1ghqa_

Details for d3oeda_

PDB Entry: 3oed, 3.16 Å

PDB Description: The structure of the complex between complement receptor CR2 and its ligand complement fragment C3d

PDB Compounds: (A:) Complement C3

SCOPe Domain Sequences for d3oeda_:

Sequence; same for both SEQRES and ATOM records:

>d3oeda_ a.102.4.4 (A:) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
mldaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy
tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk
pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag
dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat
syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap

Timeline for d3oeda_:

• d3oeda_ first appeared in SCOPe 2.04
  
• d3oeda_ is called d3oeda1 in SCOPe 2.06
  
• d3oeda_ appears in the current release, SCOPe 2.08, called d3oeda1