Lineage for d3oecb_ (3oec B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095448Species Mycobacterium thermoresistibile [TaxId:1797] [255993] (1 PDB entry)
  8. 2095450Domain d3oecb_: 3oec B: [248208]
    automated match to d3pxxc_
    complexed with na

Details for d3oecb_

PDB Entry: 3oec (more details), 1.95 Å

PDB Description: crystal structure of carveol dehydrogenase from mycobacterium thermoresistibile
PDB Compounds: (B:) Carveol dehydrogenase (MythA.01326.c, A0R518 homolog)

SCOPe Domain Sequences for d3oecb_:

Sequence, based on SEQRES records: (download)

>d3oecb_ c.2.1.0 (B:) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
nrlqgkvafitgaargqgrthavrlaqdgadivaidlcrqqpnldyaqgspeelketvrl
veeqgrriiarqadvrdlaslqavvdealaefghidilvsnvgisnqgevvsltdqqwsd
ilqtnligawhacravlpsmiergqggsvifvsstvglrgapgqshyaaskhgvqglmls
lanevgrhnirvnsvnpgavntemalnekllkmflphlenptredaaelfsqltllpipw
vepedvsnavawlasdearyihgaaipvdggqlara

Sequence, based on observed residues (ATOM records): (download)

>d3oecb_ c.2.1.0 (B:) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
nrlqgkvafitgaargqgrthavrlaqdgadivaidlcrqnldyaqgspeelketvrlve
eqgrriiarqadvrdlaslqavvdealaefghidilvsnvgisnqgevvsltdqqwsdil
qtnligawhacravlpsmiergqggsvifvsstvglrgapgqshyaaskhgvqglmlsla
nevgrhnirvnsvnpgavntemalnekllkmflphltredaaelfsqltllpipwveped
vsnavawlasdearyihgaaipvdggqlara

SCOPe Domain Coordinates for d3oecb_:

Click to download the PDB-style file with coordinates for d3oecb_.
(The format of our PDB-style files is described here.)

Timeline for d3oecb_: