SCOPe 2.08: Domain d3oe7x3: 3oe7 X:358-475

Lineage for d3oe7x3 (3oe7 X:358-475)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310898] (6 PDB entries)

8. Domain d3oe7x3: 3oe7 X:358-475 [248206]
   Other proteins in same PDB: d3oe7d1, d3oe7d2, d3oe7e1, d3oe7e2, d3oe7f1, d3oe7f2, d3oe7g_, d3oe7h1, d3oe7h2, d3oe7i_, d3oe7m1, d3oe7m2, d3oe7n1, d3oe7n2, d3oe7o1, d3oe7o2, d3oe7p_, d3oe7r_, d3oe7v1, d3oe7v2, d3oe7w1, d3oe7w2, d3oe7x1, d3oe7x2
   automated match to d2jdid1
   complexed with anp, mg, po4; mutant

Details for d3oe7x3

PDB Entry: 3oe7, 3.19 Å

PDB Description: Structure of four mutant forms of yeast f1 ATPase: gamma-I270T

PDB Compounds: (X:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oe7x3:

Sequence; same for both SEQRES and ATOM records:

>d3oe7x3 a.69.1.1 (X:358-475) F1 ATP synthase beta subunit, domain 3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa

Timeline for d3oe7x3:

• d3oe7x3 first appeared in SCOPe 2.04
  
• d3oe7x3 appears in SCOPe 2.07