Lineage for d3oe7v1 (3oe7 V:6-82)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1547881Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1547882Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) (S)
    automatically mapped to Pfam PF02874
  5. 1548010Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 1548011Protein automated matches [254527] (6 species)
    not a true protein
  7. 1548019Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255212] (6 PDB entries)
  8. 1548050Domain d3oe7v1: 3oe7 V:6-82 [248198]
    Other proteins in same PDB: d3oe7d2, d3oe7d3, d3oe7e2, d3oe7e3, d3oe7f2, d3oe7f3, d3oe7g_, d3oe7m2, d3oe7m3, d3oe7n2, d3oe7n3, d3oe7o2, d3oe7o3, d3oe7p_, d3oe7v2, d3oe7v3, d3oe7w2, d3oe7w3, d3oe7x2, d3oe7x3
    automated match to d2jdid2
    complexed with anp, mg, po4; mutant

Details for d3oe7v1

PDB Entry: 3oe7 (more details), 3.19 Å

PDB Description: Structure of four mutant forms of yeast f1 ATPase: gamma-I270T
PDB Compounds: (V:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oe7v1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oe7v1 b.49.1.0 (V:6-82) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
gteglvrgekvldtggp

SCOPe Domain Coordinates for d3oe7v1:

Click to download the PDB-style file with coordinates for d3oe7v1.
(The format of our PDB-style files is described here.)

Timeline for d3oe7v1: