Lineage for d3oe7o2 (3oe7 O:83-357)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1847928Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1848393Protein automated matches [190393] (10 species)
    not a true protein
  7. 1848398Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255213] (6 PDB entries)
  8. 1848428Domain d3oe7o2: 3oe7 O:83-357 [248195]
    Other proteins in same PDB: d3oe7d1, d3oe7d3, d3oe7e1, d3oe7e3, d3oe7f1, d3oe7f3, d3oe7g_, d3oe7m1, d3oe7m3, d3oe7n1, d3oe7n3, d3oe7o1, d3oe7o3, d3oe7p_, d3oe7v1, d3oe7v3, d3oe7w1, d3oe7w3, d3oe7x1, d3oe7x3
    automated match to d2jdid3
    complexed with anp, mg, po4; mutant

Details for d3oe7o2

PDB Entry: 3oe7 (more details), 3.19 Å

PDB Description: Structure of four mutant forms of yeast f1 ATPase: gamma-I270T
PDB Compounds: (O:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oe7o2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oe7o2 c.37.1.11 (O:83-357) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isvpvgretlgriinvigepidergpiksklrkpihadppsfaeqstsaeiletgikvvd
llapyarggkiglfggagvgktvfiqelinniakahggfsvftgvgertregndlyremk
etgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdeegqdvllfidnifrft
qagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsvqavyvpaddltdpap
attfahldattvlsrgiselgiypavdpldsksrl

SCOPe Domain Coordinates for d3oe7o2:

Click to download the PDB-style file with coordinates for d3oe7o2.
(The format of our PDB-style files is described here.)

Timeline for d3oe7o2: