Lineage for d3oe7o1 (3oe7 O:7-82)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408137Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2408138Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2408139Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 2408210Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species)
  7. 2408213Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310896] (6 PDB entries)
  8. 2408243Domain d3oe7o1: 3oe7 O:7-82 [248194]
    Other proteins in same PDB: d3oe7d2, d3oe7d3, d3oe7e2, d3oe7e3, d3oe7f2, d3oe7f3, d3oe7g_, d3oe7h1, d3oe7h2, d3oe7i_, d3oe7m2, d3oe7m3, d3oe7n2, d3oe7n3, d3oe7o2, d3oe7o3, d3oe7p_, d3oe7r_, d3oe7v2, d3oe7v3, d3oe7w2, d3oe7w3, d3oe7x2, d3oe7x3
    automated match to d2jdid2
    complexed with anp, mg, po4; mutant

Details for d3oe7o1

PDB Entry: 3oe7 (more details), 3.19 Å

PDB Description: Structure of four mutant forms of yeast f1 ATPase: gamma-I270T
PDB Compounds: (O:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oe7o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oe7o1 b.49.1.1 (O:7-82) F1 ATP synthase beta subunit, domain 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
teglvrgekvldtggp

SCOPe Domain Coordinates for d3oe7o1:

Click to download the PDB-style file with coordinates for d3oe7o1.
(The format of our PDB-style files is described here.)

Timeline for d3oe7o1: