| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
| Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
| Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310898] (6 PDB entries) |
| Domain d3oe7m3: 3oe7 M:358-475 [248190] Other proteins in same PDB: d3oe7d1, d3oe7d2, d3oe7e1, d3oe7e2, d3oe7f1, d3oe7f2, d3oe7g_, d3oe7h1, d3oe7h2, d3oe7i_, d3oe7m1, d3oe7m2, d3oe7n1, d3oe7n2, d3oe7o1, d3oe7o2, d3oe7p_, d3oe7r_, d3oe7v1, d3oe7v2, d3oe7w1, d3oe7w2, d3oe7x1, d3oe7x2 automated match to d2jdid1 complexed with anp, mg, po4; mutant |
PDB Entry: 3oe7 (more details), 3.19 Å
SCOPe Domain Sequences for d3oe7m3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oe7m3 a.69.1.1 (M:358-475) F1 ATP synthase beta subunit, domain 3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
Timeline for d3oe7m3:
View in 3DDomains from other chains: (mouse over for more information) d3oe7d1, d3oe7d2, d3oe7d3, d3oe7e1, d3oe7e2, d3oe7e3, d3oe7f1, d3oe7f2, d3oe7f3, d3oe7g_, d3oe7h1, d3oe7h2, d3oe7i_, d3oe7n1, d3oe7n2, d3oe7n3, d3oe7o1, d3oe7o2, d3oe7o3, d3oe7p_, d3oe7r_, d3oe7v1, d3oe7v2, d3oe7v3, d3oe7w1, d3oe7w2, d3oe7w3, d3oe7x1, d3oe7x2, d3oe7x3 |