SCOPe 2.07: Domain d3oe7m2: 3oe7 M:83-357

Lineage for d3oe7m2 (3oe7 M:83-357)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310897] (6 PDB entries)

8. Domain d3oe7m2: 3oe7 M:83-357 [248189]
   Other proteins in same PDB: d3oe7d1, d3oe7d3, d3oe7e1, d3oe7e3, d3oe7f1, d3oe7f3, d3oe7g_, d3oe7h1, d3oe7h2, d3oe7i_, d3oe7m1, d3oe7m3, d3oe7n1, d3oe7n3, d3oe7o1, d3oe7o3, d3oe7p_, d3oe7r_, d3oe7v1, d3oe7v3, d3oe7w1, d3oe7w3, d3oe7x1, d3oe7x3
   automated match to d2jdid3
   complexed with anp, mg, po4; mutant

Details for d3oe7m2

PDB Entry: 3oe7, 3.19 Å

PDB Description: Structure of four mutant forms of yeast f1 ATPase: gamma-I270T

PDB Compounds: (M:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oe7m2:

Sequence; same for both SEQRES and ATOM records:

>d3oe7m2 c.37.1.11 (M:83-357) Central domain of beta subunit of F1 ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isvpvgretlgriinvigepidergpiksklrkpihadppsfaeqstsaeiletgikvvd
llapyarggkiglfggagvgktvfiqelinniakahggfsvftgvgertregndlyremk
etgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdeegqdvllfidnifrft
qagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsvqavyvpaddltdpap
attfahldattvlsrgiselgiypavdpldsksrl

Timeline for d3oe7m2:

• d3oe7m2 first appeared in SCOPe 2.04
  
• d3oe7m2 appears in SCOPe 2.06
  
• d3oe7m2 appears in the current release, SCOPe 2.08