SCOPe 2.04: Domain d3oe7g_: 3oe7 G:

Lineage for d3oe7g_ (3oe7 G:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest

4. Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families)
   contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold

5. Family c.49.2.0: automated matches [191450] (1 protein)
   not a true family

6. Protein automated matches [190687] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187815] (6 PDB entries)

8. Domain d3oe7g_: 3oe7 G: [248187]
   Other proteins in same PDB: d3oe7d1, d3oe7d2, d3oe7d3, d3oe7e1, d3oe7e2, d3oe7e3, d3oe7f1, d3oe7f2, d3oe7f3, d3oe7m1, d3oe7m2, d3oe7m3, d3oe7n1, d3oe7n2, d3oe7n3, d3oe7o1, d3oe7o2, d3oe7o3, d3oe7v1, d3oe7v2, d3oe7v3, d3oe7w1, d3oe7w2, d3oe7w3, d3oe7x1, d3oe7x2, d3oe7x3
   automated match to d2v7qg_
   complexed with anp, mg, po4; mutant

Details for d3oe7g_

PDB Entry: 3oe7, 3.19 Å

PDB Description: Structure of four mutant forms of yeast f1 ATPase: gamma-I270T

PDB Compounds: (G:) ATP synthase subunit gamma

SCOPe Domain Sequences for d3oe7g_:

Sequence, based on SEQRES records:

>d3oe7g_ c.49.2.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
sknagdminrysilynrtrqavitnelvdtitgass

Sequence, based on observed residues (ATOM records):

>d3oe7g_ c.49.2.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknk
elivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllrthpnniklsin
gigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsekpifnaktieqs
psfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdnasknagdminry
silynrtrqavitnelvdtitgass

Timeline for d3oe7g_:

• d3oe7g_ is new in SCOPe 2.04-stable
  
• d3oe7g_ appears in SCOPe 2.05
  
• d3oe7g_ appears in the current release, SCOPe 2.08