Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310897] (6 PDB entries) |
Domain d3oe7f2: 3oe7 F:83-357 [248185] Other proteins in same PDB: d3oe7d1, d3oe7d3, d3oe7e1, d3oe7e3, d3oe7f1, d3oe7f3, d3oe7g_, d3oe7h1, d3oe7h2, d3oe7i_, d3oe7m1, d3oe7m3, d3oe7n1, d3oe7n3, d3oe7o1, d3oe7o3, d3oe7p_, d3oe7r_, d3oe7v1, d3oe7v3, d3oe7w1, d3oe7w3, d3oe7x1, d3oe7x3 automated match to d2jdid3 complexed with anp, mg, po4; mutant |
PDB Entry: 3oe7 (more details), 3.19 Å
SCOPe Domain Sequences for d3oe7f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oe7f2 c.37.1.11 (F:83-357) Central domain of beta subunit of F1 ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} isvpvgretlgriinvigepidergpiksklrkpihadppsfaeqstsaeiletgikvvd llapyarggkiglfggagvgktvfiqelinniakahggfsvftgvgertregndlyremk etgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdeegqdvllfidnifrft qagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsvqavyvpaddltdpap attfahldattvlsrgiselgiypavdpldsksrl
Timeline for d3oe7f2:
View in 3D Domains from other chains: (mouse over for more information) d3oe7d1, d3oe7d2, d3oe7d3, d3oe7e1, d3oe7e2, d3oe7e3, d3oe7g_, d3oe7h1, d3oe7h2, d3oe7i_, d3oe7m1, d3oe7m2, d3oe7m3, d3oe7n1, d3oe7n2, d3oe7n3, d3oe7o1, d3oe7o2, d3oe7o3, d3oe7p_, d3oe7r_, d3oe7v1, d3oe7v2, d3oe7v3, d3oe7w1, d3oe7w2, d3oe7w3, d3oe7x1, d3oe7x2, d3oe7x3 |