Lineage for d3oe7d3 (3oe7 D:358-475)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1494900Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1494901Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families) (S)
  5. 1495029Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 1495030Protein automated matches [254528] (6 species)
    not a true protein
  7. 1495038Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255214] (6 PDB entries)
  8. 1495063Domain d3oe7d3: 3oe7 D:358-475 [248180]
    Other proteins in same PDB: d3oe7d1, d3oe7d2, d3oe7e1, d3oe7e2, d3oe7f1, d3oe7f2, d3oe7g_, d3oe7m1, d3oe7m2, d3oe7n1, d3oe7n2, d3oe7o1, d3oe7o2, d3oe7p_, d3oe7v1, d3oe7v2, d3oe7w1, d3oe7w2, d3oe7x1, d3oe7x2
    automated match to d2jdid1
    complexed with anp, mg, po4; mutant

Details for d3oe7d3

PDB Entry: 3oe7 (more details), 3.19 Å

PDB Description: Structure of four mutant forms of yeast f1 ATPase: gamma-I270T
PDB Compounds: (D:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oe7d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oe7d3 a.69.1.0 (D:358-475) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa

SCOPe Domain Coordinates for d3oe7d3:

Click to download the PDB-style file with coordinates for d3oe7d3.
(The format of our PDB-style files is described here.)

Timeline for d3oe7d3: