Lineage for d3oe1d3 (3oe1 D:363-566)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592643Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1592644Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. Protein automated matches [227126] (15 species)
    not a true protein
  7. 1593493Species Zymomonas mobilis [TaxId:542] [255668] (4 PDB entries)
  8. 1593509Domain d3oe1d3: 3oe1 D:363-566 [248177]
    Other proteins in same PDB: d3oe1a2, d3oe1b2, d3oe1c2, d3oe1d2
    automated match to d1zpda3
    complexed with gol, mg, tdl

Details for d3oe1d3

PDB Entry: 3oe1 (more details), 1.99 Å

PDB Description: pyruvate decarboxylase variant glu473asp from z. mobilis in complex with reaction intermediate 2-lactyl-thdp
PDB Compounds: (D:) pyruvate decarboxylase

SCOPe Domain Sequences for d3oe1d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oe1d3 c.36.1.0 (D:363-566) automated matches {Zymomonas mobilis [TaxId: 542]}
aplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpaa
fgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytidvmihdgpyn
niknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigre
dcteelvkwgkrvaaansrkpvnk

SCOPe Domain Coordinates for d3oe1d3:

Click to download the PDB-style file with coordinates for d3oe1d3.
(The format of our PDB-style files is described here.)

Timeline for d3oe1d3: