Lineage for d3oe1d2 (3oe1 D:188-362)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2863020Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2863021Protein automated matches [190312] (14 species)
    not a true protein
  7. 2863135Species Zymomonas mobilis [TaxId:542] [255669] (6 PDB entries)
  8. 2863139Domain d3oe1d2: 3oe1 D:188-362 [248176]
    Other proteins in same PDB: d3oe1a1, d3oe1a3, d3oe1b1, d3oe1b3, d3oe1c1, d3oe1c3, d3oe1d1, d3oe1d3
    automated match to d1zpda1
    complexed with gol, mg, tdl

Details for d3oe1d2

PDB Entry: 3oe1 (more details), 1.99 Å

PDB Description: pyruvate decarboxylase variant glu473asp from z. mobilis in complex with reaction intermediate 2-lactyl-thdp
PDB Compounds: (D:) pyruvate decarboxylase

SCOPe Domain Sequences for d3oe1d2:

Sequence, based on SEQRES records: (download)

>d3oe1d2 c.31.1.0 (D:188-362) automated matches {Zymomonas mobilis [TaxId: 542]}
easdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggavatmaaak
sffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdpkklvla
eprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadps

Sequence, based on observed residues (ATOM records): (download)

>d3oe1d2 c.31.1.0 (D:188-362) automated matches {Zymomonas mobilis [TaxId: 542]}
easdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggavatmaaak
sffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdpkklvla
eprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslndps

SCOPe Domain Coordinates for d3oe1d2:

Click to download the PDB-style file with coordinates for d3oe1d2.
(The format of our PDB-style files is described here.)

Timeline for d3oe1d2: