| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
| Protein automated matches [190312] (14 species) not a true protein |
| Species Zymomonas mobilis [TaxId:542] [255669] (6 PDB entries) |
| Domain d3oe1b2: 3oe1 B:188-362 [248170] Other proteins in same PDB: d3oe1a1, d3oe1a3, d3oe1b1, d3oe1b3, d3oe1c1, d3oe1c3, d3oe1d1, d3oe1d3 automated match to d1zpda1 complexed with gol, mg, tdl |
PDB Entry: 3oe1 (more details), 1.99 Å
SCOPe Domain Sequences for d3oe1b2:
Sequence, based on SEQRES records: (download)
>d3oe1b2 c.31.1.0 (B:188-362) automated matches {Zymomonas mobilis [TaxId: 542]}
easdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggavatmaaak
sffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdpkklvla
eprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadps
>d3oe1b2 c.31.1.0 (B:188-362) automated matches {Zymomonas mobilis [TaxId: 542]}
easdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggavatmaaak
sffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdpkklvla
eprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnaaapadps
Timeline for d3oe1b2: