SCOPe 2.04: Domain d3oc3d2: 3oc3 D:114-196

Lineage for d3oc3d2 (3oc3 D:114-196)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.0: automated matches [227265] (1 protein)
   not a true family

6. Protein automated matches [227057] (3 species)
   not a true protein

7. Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [232060] (3 PDB entries)

8. Domain d3oc3d2: 3oc3 D:114-196 [248161]
   automated match to d1ytba2
   complexed with mes

Details for d3oc3d2

PDB Entry: 3oc3, 3.1 Å

PDB Description: Crystal structure of the Mot1 N-terminal domain in complex with TBP

PDB Compounds: (D:) transcription initiation factor tfiid (tfiid-1)

SCOPe Domain Sequences for d3oc3d2:

Sequence; same for both SEQRES and ATOM records:

>d3oc3d2 d.129.1.0 (D:114-196) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
kiqnivsscdikfsirleglayahsnycsyepelfpgliyrmvkpkivllifvsgkivlt
gakvrddiyqafnniypvliqhr

Timeline for d3oc3d2:

• d3oc3d2 is new in SCOPe 2.04-stable
  
• d3oc3d2 appears in SCOPe 2.05
  
• d3oc3d2 appears in the current release, SCOPe 2.08