SCOPe 2.07: Domain d3oc3d1: 3oc3 D:19-113

Lineage for d3oc3d1 (3oc3 D:19-113)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.0: automated matches [227265] (1 protein)
   not a true family

6. Protein automated matches [227057] (4 species)
   not a true protein

7. Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [232060] (3 PDB entries)

8. Domain d3oc3d1: 3oc3 D:19-113 [248160]
   automated match to d1ytba1
   complexed with mes

Details for d3oc3d1

PDB Entry: 3oc3, 3.1 Å

PDB Description: Crystal structure of the Mot1 N-terminal domain in complex with TBP

PDB Compounds: (D:) transcription initiation factor tfiid (tfiid-1)

SCOPe Domain Sequences for d3oc3d1:

Sequence; same for both SEQRES and ATOM records:

>d3oc3d1 d.129.1.0 (D:19-113) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
sgiiptlqnvvatvnlsckldlknialrarnaeynpkrfaavimrirepkttalifasgk
mvitgaksekssrmaaqryakiihklgfnatfddf

Timeline for d3oc3d1:

• d3oc3d1 first appeared in SCOPe 2.04
  
• d3oc3d1 appears in SCOPe 2.06
  
• d3oc3d1 appears in the current release, SCOPe 2.08