Lineage for d3oc3d1 (3oc3 D:19-113)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668833Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1668834Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 1669013Family d.129.1.0: automated matches [227265] (1 protein)
    not a true family
  6. 1669014Protein automated matches [227057] (3 species)
    not a true protein
  7. 1669015Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [232060] (3 PDB entries)
  8. 1669026Domain d3oc3d1: 3oc3 D:19-113 [248160]
    automated match to d1ytba1
    complexed with mes

Details for d3oc3d1

PDB Entry: 3oc3 (more details), 3.1 Å

PDB Description: Crystal structure of the Mot1 N-terminal domain in complex with TBP
PDB Compounds: (D:) transcription initiation factor tfiid (tfiid-1)

SCOPe Domain Sequences for d3oc3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oc3d1 d.129.1.0 (D:19-113) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
sgiiptlqnvvatvnlsckldlknialrarnaeynpkrfaavimrirepkttalifasgk
mvitgaksekssrmaaqryakiihklgfnatfddf

SCOPe Domain Coordinates for d3oc3d1:

Click to download the PDB-style file with coordinates for d3oc3d1.
(The format of our PDB-style files is described here.)

Timeline for d3oc3d1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3oc3d2