Lineage for d3oawa4 (3oaw A:726-1093)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542186Family d.144.1.4: Phoshoinositide 3-kinase (PI3K), catalytic domain [56171] (2 proteins)
  6. 2542190Protein Phoshoinositide 3-kinase (PI3K), catalytic domain [56172] (2 species)
  7. 2542191Species Human (Homo sapiens) [TaxId:9606] [56174] (72 PDB entries)
  8. 2542210Domain d3oawa4: 3oaw A:726-1093 [248157]
    Other proteins in same PDB: d3oawa1, d3oawa2, d3oawa3
    automated match to d1e7ua4
    complexed with oaw

Details for d3oawa4

PDB Entry: 3oaw (more details), 2.75 Å

PDB Description: 4-Methylpteridineones as Orally Active and Selective PI3K/mTOR Dual Inhibitors
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3oawa4:

Sequence, based on SEQRES records: (download)

>d3oawa4 d.144.1.4 (A:726-1093) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfn
wflhlvlg

Sequence, based on observed residues (ATOM records): (download)

>d3oawa4 d.144.1.4 (A:726-1093) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsssqvisqlkqklenlqnsqlpesfrvpydpgl
kagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrim
esiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwl
kekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgn
yrvpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmp
qltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlg

SCOPe Domain Coordinates for d3oawa4:

Click to download the PDB-style file with coordinates for d3oawa4.
(The format of our PDB-style files is described here.)

Timeline for d3oawa4: