Lineage for d1ey4a_ (1ey4 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397498Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 2397499Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 2397500Protein Staphylococcal nuclease [50201] (1 species)
  7. 2397501Species Staphylococcus aureus [TaxId:1280] [50202] (270 PDB entries)
    Uniprot P00644 89-223
  8. 2397523Domain d1ey4a_: 1ey4 A: [24815]
    mutant

Details for d1ey4a_

PDB Entry: 1ey4 (more details), 1.6 Å

PDB Description: structure of s. nuclease stabilizing mutant s59a
PDB Compounds: (A:) staphylococcal nuclease

SCOPe Domain Sequences for d1ey4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ey4a_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeaaaftkkm
venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhl
rkseaqakkeklniws

SCOPe Domain Coordinates for d1ey4a_:

Click to download the PDB-style file with coordinates for d1ey4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ey4a_: