Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) |
Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
Protein automated matches [190499] (20 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:170187] [255991] (5 PDB entries) |
Domain d3o94a_: 3o94 A: [248145] automated match to d3hb7b_ complexed with nca, zn |
PDB Entry: 3o94 (more details), 1.6 Å
SCOPe Domain Sequences for d3o94a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o94a_ c.33.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]} mtkalisidytedfvadsgkltagapaqaisdaiskvtrlafergdyifftidaheendc fhpesklfpphnligtsgrnlygdlgifyqehgsdsrvfwmdkrhysafsgtdldirlre rrvstviltgvltdisvlhtaidaynlgydieivkpavasiwpenhqfalghfkntlgak lvdenlnel
Timeline for d3o94a_: