SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3o94a_ (3o94 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108002Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2108003Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2108056Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2108057Protein automated matches [190499] (20 species)
    not a true protein
  7. 2108139Species Streptococcus pneumoniae [TaxId:170187] [255991] (5 PDB entries)
  8. 2108140Domain d3o94a_: 3o94 A: [248145]
    automated match to d3hb7b_
    complexed with nca, zn

Details for d3o94a_

PDB Entry: 3o94 (more details), 1.6 Å

PDB Description: High resolution crystal structures of Streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into catalytic mechanism and inhibition by aldehydes
PDB Compounds: (A:) Nicotinamidase

SCOPe Domain Sequences for d3o94a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o94a_ c.33.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
mtkalisidytedfvadsgkltagapaqaisdaiskvtrlafergdyifftidaheendc
fhpesklfpphnligtsgrnlygdlgifyqehgsdsrvfwmdkrhysafsgtdldirlre
rrvstviltgvltdisvlhtaidaynlgydieivkpavasiwpenhqfalghfkntlgak
lvdenlnel

SCOPe Domain Coordinates for d3o94a_:

Click to download the PDB-style file with coordinates for d3o94a_.
(The format of our PDB-style files is described here.)

Timeline for d3o94a_: