Lineage for d3o93c_ (3o93 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864173Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864174Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2864227Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2864228Protein automated matches [190499] (26 species)
    not a true protein
  7. 2864366Species Streptococcus pneumoniae [TaxId:170187] [255991] (5 PDB entries)
  8. 2864377Domain d3o93c_: 3o93 C: [248143]
    automated match to d3hb7b_
    complexed with zn

Details for d3o93c_

PDB Entry: 3o93 (more details), 1.84 Å

PDB Description: High resolution crystal structures of Streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into catalytic mechanism and inhibition by aldehydes
PDB Compounds: (C:) Nicotinamidase

SCOPe Domain Sequences for d3o93c_:

Sequence, based on SEQRES records: (download)

>d3o93c_ c.33.1.0 (C:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
mtkalisidytedfvadsgkltagapaqaisdaiskvtrlafergdyifftidaheendc
fhpesklfpphnligtsgrnlygdlgifyqehgsdsrvfwmdkrhysafsgtdldirlre
rrvstviltgvltdixvlhtaidaynlgydieivkpavasiwpenhqfalghfkntlgak
lvdenlnelf

Sequence, based on observed residues (ATOM records): (download)

>d3o93c_ c.33.1.0 (C:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
mtkalisidytedfvadsgkltagapaqaisdaiskvtrlafergdyifftidahedcfh
pesklfpphnligtsgrnlygdlgifyqehgsdsrvfwmdkrhysafsgtdldirlrerr
vstviltgvltdixvlhtaidaynlgydieivkpavasiwpenhqfalghfkntlgaklv
denlnelf

SCOPe Domain Coordinates for d3o93c_:

Click to download the PDB-style file with coordinates for d3o93c_.
(The format of our PDB-style files is described here.)

Timeline for d3o93c_: