SCOPe 2.06: Domain d3o91c_: 3o91 C:

Lineage for d3o91c_ (3o91 C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.0: automated matches [191389] (1 protein)
   not a true family

6. Protein automated matches [190499] (22 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [255991] (5 PDB entries)

8. Domain d3o91c_: 3o91 C: [248135]
   automated match to d3hb7b_
   complexed with zn

Details for d3o91c_

PDB Entry: 3o91, 1.63 Å

PDB Description: High resolution crystal structures of Streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into catalytic mechanism and inhibition by aldehydes

PDB Compounds: (C:) Nicotinamidase

SCOPe Domain Sequences for d3o91c_:

Sequence, based on SEQRES records:

>d3o91c_ c.33.1.0 (C:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
tkalisidytedfvadsgkltagapaqaisdaiskvtrlafergdyifftidaheendcf
hpesklfpphnligtsgrnlygdlgifyqehgsdsrvfwmdkrhysafsgtdldirlrer
rvstviltgvltdixvlhtaidaynlgydieivkpavasiwpenhqfalghfkntlgakl
vdenlnelf

Sequence, based on observed residues (ATOM records):

>d3o91c_ c.33.1.0 (C:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
tkalisidytedfvadsgkltagapaqaisdaiskvtrlafergdyifftidahendcfh
pesklfpphnligtsgrnlygdlgifyqehgsdsrvfwmdkrhysafsgtdldirlrerr
vstviltgvltdixvlhtaidaynlgydieivkpavasiwpenhqfalghfkntlgaklv
denlnelf

Timeline for d3o91c_:

• d3o91c_ first appeared in SCOPe 2.04
  
• d3o91c_ appears in SCOPe 2.05
  
• d3o91c_ appears in SCOPe 2.07
  
• d3o91c_ appears in the current release, SCOPe 2.08