Lineage for d3o90d_ (3o90 D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592439Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1592440Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 1592474Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 1592475Protein automated matches [190499] (20 species)
    not a true protein
  7. 1592542Species Streptococcus pneumoniae [TaxId:170187] [255991] (5 PDB entries)
  8. 1592562Domain d3o90d_: 3o90 D: [248132]
    automated match to d3hb7d_
    complexed with zn

Details for d3o90d_

PDB Entry: 3o90 (more details), 1.94 Å

PDB Description: High resolution crystal structures of Streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into catalytic mechanism and inhibition by aldehydes
PDB Compounds: (D:) Nicotinamidase

SCOPe Domain Sequences for d3o90d_:

Sequence, based on SEQRES records: (download)

>d3o90d_ c.33.1.0 (D:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
tkalisidytedfvadsgkltagapaqaisdaiskvtrlafergdyifftidaheendcf
hpesklfpphnligtsgrnlygdlgifyqehgsdsrvfwmdkrhysafsgtdldirlrer
rvstviltgvltdicvlhtaidaynlgydieivkpavasiwpenhqfalghfkntlgakl
vdenlnelf

Sequence, based on observed residues (ATOM records): (download)

>d3o90d_ c.33.1.0 (D:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
tkalisidytedfvadsgkltagapaqaisdaiskvtrlafergdyifftidahedcfhp
esklfpphnligtsgrnlygdlgifyqehgsdsrvfwmdkrhysafsgtdldirlrerrv
stviltgvltdicvlhtaidaynlgydieivkpavasiwpenhqfalghfkntlgaklvd
enlnelf

SCOPe Domain Coordinates for d3o90d_:

Click to download the PDB-style file with coordinates for d3o90d_.
(The format of our PDB-style files is described here.)

Timeline for d3o90d_: