SCOPe 2.05: Domain d1snca_: 1snc A:

Lineage for d1snca_ (1snc A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family)

5. Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein Staphylococcal nuclease [50201] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50202] (227 PDB entries)
   Uniprot P00644 89-223

8. Domain d1snca_: 1snc A: [24813]
   complexed with ca, thp

Details for d1snca_

PDB Entry: 1snc, 1.65 Å

PDB Description: the crystal structure of the ternary complex of staphylococcal nuclease, ca2+, and the inhibitor pd*tp, refined at 1.65 angstroms

PDB Compounds: (A:) thermonuclease precursor

SCOPe Domain Sequences for d1snca_:

Sequence; same for both SEQRES and ATOM records:

>d1snca_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
kseaqakkeklniws

Timeline for d1snca_:

• d1snca_ first appeared (with stable ids) in SCOP 1.55, called d1snc__
  
• d1snca_ appears in SCOPe 2.04
  
• d1snca_ appears in SCOPe 2.06
  
• d1snca_ appears in the current release, SCOPe 2.08