Lineage for d3o8ha1 (3o8h A:22-94)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2306149Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2306150Protein automated matches [190674] (25 species)
    not a true protein
  7. 2306262Species Mycobacterium tuberculosis [TaxId:1773] [232223] (13 PDB entries)
  8. 2306269Domain d3o8ha1: 3o8h A:22-94 [248127]
    Other proteins in same PDB: d3o8ha2
    automated match to d3g1ma1
    protein/DNA complex; complexed with o8h

Details for d3o8ha1

PDB Entry: 3o8h (more details), 1.9 Å

PDB Description: EthR from Mycobacterium tuberculosis in complex with compound BDM14950
PDB Compounds: (A:) transcriptional regulatory repressor protein (tetr-family) ethr

SCOPe Domain Sequences for d3o8ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o8ha1 a.4.1.0 (A:22-94) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

SCOPe Domain Coordinates for d3o8ha1:

Click to download the PDB-style file with coordinates for d3o8ha1.
(The format of our PDB-style files is described here.)

Timeline for d3o8ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3o8ha2