| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
| Protein automated matches [190674] (14 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [232223] (12 PDB entries) |
| Domain d3o8ha1: 3o8h A:22-94 [248127] Other proteins in same PDB: d3o8ha2 automated match to d3g1ma1 protein/DNA complex; complexed with o8h |
PDB Entry: 3o8h (more details), 1.9 Å
SCOPe Domain Sequences for d3o8ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o8ha1 a.4.1.0 (A:22-94) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp
Timeline for d3o8ha1: