SCOPe 2.08: Domain d3o8ha1: 3o8h A:22-94

Lineage for d3o8ha1 (3o8h A:22-94)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (25 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [232223] (13 PDB entries)

8. Domain d3o8ha1: 3o8h A:22-94 [248127]
   Other proteins in same PDB: d3o8ha2
   automated match to d3g1ma1
   protein/DNA complex; complexed with o8h

Details for d3o8ha1

PDB Entry: 3o8h, 1.9 Å

PDB Description: EthR from Mycobacterium tuberculosis in complex with compound BDM14950

PDB Compounds: (A:) transcriptional regulatory repressor protein (tetr-family) ethr

SCOPe Domain Sequences for d3o8ha1:

Sequence; same for both SEQRES and ATOM records:

>d3o8ha1 a.4.1.0 (A:22-94) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

Timeline for d3o8ha1:

• d3o8ha1 first appeared in SCOPe 2.04
  
• d3o8ha1 appears in SCOPe 2.07