Lineage for d3o8ga2 (3o8g A:95-215)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011555Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2011556Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2011557Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2011877Protein automated matches [226970] (7 species)
    not a true protein
  7. 2011908Species Mycobacterium tuberculosis [TaxId:1773] [232226] (7 PDB entries)
  8. 2011909Domain d3o8ga2: 3o8g A:95-215 [248126]
    Other proteins in same PDB: d3o8ga1
    automated match to d3g1ma2
    protein/DNA complex; complexed with o8g

Details for d3o8ga2

PDB Entry: 3o8g (more details), 1.9 Å

PDB Description: EthR from Mycobacterium tuberculosis in complex with compound BDM14801
PDB Compounds: (A:) transcriptional regulatory repressor protein (tetr-family) ethr

SCOPe Domain Sequences for d3o8ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o8ga2 a.121.1.1 (A:95-215) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
n

SCOPe Domain Coordinates for d3o8ga2:

Click to download the PDB-style file with coordinates for d3o8ga2.
(The format of our PDB-style files is described here.)

Timeline for d3o8ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3o8ga1