| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
| Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
| Protein automated matches [226970] (6 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [232226] (7 PDB entries) |
| Domain d3o8ga2: 3o8g A:95-215 [248126] Other proteins in same PDB: d3o8ga1 automated match to d3g1ma2 protein/DNA complex; complexed with o8g |
PDB Entry: 3o8g (more details), 1.9 Å
SCOPe Domain Sequences for d3o8ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o8ga2 a.121.1.1 (A:95-215) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
n
Timeline for d3o8ga2: