Lineage for d3o63a1 (3o63 A:1-221)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2414817Superfamily c.1.3: Thiamin phosphate synthase [51391] (2 families) (S)
    automatically mapped to Pfam PF02581
  5. 2414844Family c.1.3.0: automated matches [254309] (1 protein)
    not a true family
  6. 2414845Protein automated matches [254710] (1 species)
    not a true protein
  7. 2414846Species Mycobacterium tuberculosis [TaxId:1773] [255989] (1 PDB entry)
  8. 2414847Domain d3o63a1: 3o63 A:1-221 [248122]
    Other proteins in same PDB: d3o63a2
    automated match to d1xi3a_
    complexed with po4

Details for d3o63a1

PDB Entry: 3o63 (more details), 2.35 Å

PDB Description: crystal structure of thiamin phosphate synthase from mycobacterium tuberculosis
PDB Compounds: (A:) Probable thiamine-phosphate pyrophosphorylase

SCOPe Domain Sequences for d3o63a1:

Sequence, based on SEQRES records: (download)

>d3o63a1 c.1.3.0 (A:1-221) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mhesrlasarlylctdarrergdlaqfaeaalaggvdiiqlrdkgspgelrfgplqarde
laaceiladaahrygalfavndradiaraagadvlhlgqrdlpvnvarqilapdtligrs
thdpdqvaaaaagdadyfcvgpcwptptkpgraapglglvrvaaelggddkpwfaiggin
aqrlpavldagarrivvvraitsaddpraaaeqlrsaltaa

Sequence, based on observed residues (ATOM records): (download)

>d3o63a1 c.1.3.0 (A:1-221) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mhesrlasarlylctdarrergdlaqfaeaalaggvdiiqlrdkgspgelrfgplqarde
laaceiladaahrygalfavndradiaraagadvlhlgqrdlpvnvarqilapdtligrs
thdpdqvaaaaagdadyfcvgpcwptptapglglvrvaaeldkpwfaigginaqrlpavl
dagarrivvvraitsaddpraaaeqlrsaltaa

SCOPe Domain Coordinates for d3o63a1:

Click to download the PDB-style file with coordinates for d3o63a1.
(The format of our PDB-style files is described here.)

Timeline for d3o63a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3o63a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3o63b_