SCOPe 2.05: Domain d3o05b_: 3o05 B:

Lineage for d3o05b_ (3o05 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (26 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255829] (4 PDB entries)

8. Domain d3o05b_: 3o05 B: [248112]
   automated match to d1znna1
   complexed with plp

Details for d3o05b_

PDB Entry: 3o05, 2.2 Å

PDB Description: Crystal Structure of Yeast Pyridoxal 5-Phosphate Synthase Snz1 Complxed with Substrate PLP

PDB Compounds: (B:) Pyridoxine biosynthesis protein SNZ1

SCOPe Domain Sequences for d3o05b_:

Sequence; same for both SEQRES and ATOM records:

>d3o05b_ c.1.2.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmikdimnsvs
ipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvcgakdlgea
lrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakvaeemrvpvs
llkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvrlatavvea
tthfdnpskllevssdlgelm

Timeline for d3o05b_:

• d3o05b_ first appeared in SCOPe 2.04
  
• d3o05b_ appears in SCOPe 2.06
  
• d3o05b_ appears in the current release, SCOPe 2.08