Lineage for d1ffkh_ (1ffk H:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667238Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 667239Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 667240Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 667241Protein Ribosomal protein L14 [50195] (3 species)
  7. 667242Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (40 PDB entries)
  8. 667274Domain d1ffkh_: 1ffk H: [24811]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_
    complexed with cd, k, mo3; mutant

Details for d1ffkh_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
PDB Compounds: (H:) ribosomal protein l14

SCOP Domain Sequences for d1ffkh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffkh_ b.39.1.1 (H:) Ribosomal protein L14 {Archaeon Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOP Domain Coordinates for d1ffkh_:

Click to download the PDB-style file with coordinates for d1ffkh_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkh_: