SCOPe 2.06: Domain d3nzua3: 3nzu A:546-725

Lineage for d3nzua3 (3nzu A:546-725)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
   automatically mapped to Pfam PF00613
   this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain

6. Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48402] (65 PDB entries)

8. Domain d3nzua3: 3nzu A:546-725 [248109]
   Other proteins in same PDB: d3nzua1, d3nzua2, d3nzua4
   automated match to d1e7ua1
   complexed with nzu

Details for d3nzua3

PDB Entry: 3nzu, 2.6 Å

PDB Description: Structure-based Optimization of Pyrazolo -Pyrimidine and -Pyridine Inhibitors of PI3-Kinase

PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3nzua3:

Sequence; same for both SEQRES and ATOM records:

>d3nzua3 a.118.1.6 (A:546-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
empnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiva
ktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvq
avkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcg

Timeline for d3nzua3:

• d3nzua3 first appeared in SCOPe 2.04
  
• d3nzua3 appears in SCOPe 2.05
  
• d3nzua3 appears in SCOPe 2.07
  
• d3nzua3 appears in the current release, SCOPe 2.08