Lineage for d3nzua3 (3nzu A:546-725)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2332885Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
  6. 2332886Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 2332887Species Human (Homo sapiens) [TaxId:9606] [48402] (68 PDB entries)
  8. 2332892Domain d3nzua3: 3nzu A:546-725 [248109]
    Other proteins in same PDB: d3nzua1, d3nzua2, d3nzua4
    automated match to d1e7ua1
    complexed with nzu

Details for d3nzua3

PDB Entry: 3nzu (more details), 2.6 Å

PDB Description: Structure-based Optimization of Pyrazolo -Pyrimidine and -Pyridine Inhibitors of PI3-Kinase
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3nzua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nzua3 a.118.1.6 (A:546-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
empnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiva
ktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvq
avkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcg

SCOPe Domain Coordinates for d3nzua3:

Click to download the PDB-style file with coordinates for d3nzua3.
(The format of our PDB-style files is described here.)

Timeline for d3nzua3: