SCOPe 2.07: Domain d3nzsa3: 3nzs A:528-725

Lineage for d3nzsa3 (3nzs A:528-725)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (27 families)

5. Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
   automatically mapped to Pfam PF00613

6. Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48402] (68 PDB entries)

8. Domain d3nzsa3: 3nzs A:528-725 [248105]
   Other proteins in same PDB: d3nzsa1, d3nzsa2, d3nzsa4
   automated match to d1e7ua1
   complexed with nzs

Details for d3nzsa3

PDB Entry: 3nzs, 2.75 Å

PDB Description: Structure-based Optimization of Pyrazolo -Pyrimidine and -Pyridine Inhibitors of PI3-Kinase

PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3nzsa3:

Sequence, based on SEQRES records:

>d3nzsa3 a.118.1.6 (A:528-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
alpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpk
aypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqk
lesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsr
hyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records):

>d3nzsa3 a.118.1.6 (A:528-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
alpkempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqq
eivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyll
qlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileayl
rgcg

Timeline for d3nzsa3:

• d3nzsa3 first appeared in SCOPe 2.04
  
• d3nzsa3 appears in SCOPe 2.06