Lineage for d1whi__ (1whi -)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166202Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
  4. 166203Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 166204Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 166205Protein Ribosomal protein L14 [50195] (2 species)
  7. 166214Species Bacillus stearothermophilus [TaxId:1422] [50196] (1 PDB entry)
  8. 166215Domain d1whi__: 1whi - [24810]

Details for d1whi__

PDB Entry: 1whi (more details), 1.5 Å

PDB Description: ribosomal protein l14

SCOP Domain Sequences for d1whi__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whi__ b.39.1.1 (-) Ribosomal protein L14 {Bacillus stearothermophilus}
miqqesrlkvadnsgarevlvikvlggsgrryanigdvvvatvkdatpggvvkkgqvvka
vvvrtkrgvrrpdgsyirfdenacviirddksprgtrifgpvarelrdkdfmkiislape
vi

SCOP Domain Coordinates for d1whi__:

Click to download the PDB-style file with coordinates for d1whi__.
(The format of our PDB-style files is described here.)

Timeline for d1whi__: