SCOPe 2.08: Domain d1whia_: 1whi A:

Lineage for d1whia_ (1whi A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
   barrel, closed; n=5, S=8, meander

4. Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family)
   automatically mapped to Pfam PF00238

5. Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)

6. Protein Ribosomal protein L14 [50195] (5 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [50196] (1 PDB entry)

8. Domain d1whia_: 1whi A: [24810]
   CASP1

Details for d1whia_

PDB Entry: 1whi, 1.5 Å

PDB Description: ribosomal protein l14

PDB Compounds: (A:) ribosomal protein l14

SCOPe Domain Sequences for d1whia_:

Sequence; same for both SEQRES and ATOM records:

>d1whia_ b.39.1.1 (A:) Ribosomal protein L14 {Bacillus stearothermophilus [TaxId: 1422]}
miqqesrlkvadnsgarevlvikvlggsgrryanigdvvvatvkdatpggvvkkgqvvka
vvvrtkrgvrrpdgsyirfdenacviirddksprgtrifgpvarelrdkdfmkiislape
vi

Timeline for d1whia_:

• d1whia_ first appeared (with stable ids) in SCOP 1.55, called d1whi__
  
• d1whia_ appears in SCOPe 2.07