SCOPe 2.05: Domain d3nwyf_: 3nwy F:

Lineage for d3nwyf_ (3nwy F:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.0: automated matches [191466] (1 protein)
   not a true family

6. Protein automated matches [190728] (15 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [255987] (1 PDB entry)

8. Domain d3nwyf_: 3nwy F: [248098]
   automated match to d1z9da1
   complexed with gtp, udp

Details for d3nwyf_

PDB Entry: 3nwy, 2.54 Å

PDB Description: Structure and allosteric regulation of the uridine monophosphate kinase from Mycobacterium tuberculosis

PDB Compounds: (F:) uridylate kinase

SCOPe Domain Sequences for d3nwyf_:

Sequence, based on SEQRES records:

>d3nwyf_ c.73.1.0 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gysrvllklggemfgggqvgldpdvvaqvarqiadvvrggvqiavvigggnffrgaqlqq
lgmertrsdymgmlgtvmnslalqdflekegivtrvqtaitmgqvaepylplravrhlek
grvvifgagmglpyfstdttaaqraleigadvvlmakavdgvfaedprvnpeaelltavs
hrevldrglrvadatafslcmdngmpilvfnlltdgniaravrgekigtlvtt

Sequence, based on observed residues (ATOM records):

>d3nwyf_ c.73.1.0 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gysrvllklggemfgggqvgldpdvvaqvarqiadvvrggvqiavvigggnffrgaqlqq
lgmertrsdymgmlgtvmnslalqdflekegivtrvqtaitmgqvaepylplravrhlek
grvvifgagmglpyfstdttaaqraleigadvvlmakavdgvfaedelltavshrevldr
glrvadatafslcmdngmpilvfnlltdgniaravrgekigtlvtt

Timeline for d3nwyf_:

• d3nwyf_ first appeared in SCOPe 2.04
  
• d3nwyf_ appears in SCOPe 2.06
  
• d3nwyf_ appears in the current release, SCOPe 2.08