Lineage for d3nvzk2 (3nvz K:415-528)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962835Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2962998Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2963058Family d.87.2.0: automated matches [232089] (1 protein)
    not a true family
  6. 2963059Protein automated matches [232090] (5 species)
    not a true protein
  7. 2963060Species Cow (Bos taurus) [TaxId:9913] [232091] (11 PDB entries)
  8. 2963068Domain d3nvzk2: 3nvz K:415-528 [248074]
    Other proteins in same PDB: d3nvza1, d3nvza2, d3nvzb1, d3nvzc1, d3nvzc2, d3nvzj1, d3nvzj2, d3nvzk1, d3nvzl1, d3nvzl2
    automated match to d3eub32
    complexed with fad, fes, i3a, mos, mte

Details for d3nvzk2

PDB Entry: 3nvz (more details), 1.6 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Indole-3-Aldehyde
PDB Compounds: (K:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvzk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nvzk2 d.87.2.0 (K:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

SCOPe Domain Coordinates for d3nvzk2:

Click to download the PDB-style file with coordinates for d3nvzk2.
(The format of our PDB-style files is described here.)

Timeline for d3nvzk2: